Subject to Change
Skateboarding is the best. Eat shit and live. Art Foundation Student based in Bucks.
"Not getting caught up in everyone’s bullshit"-Cardiel fucking knows, 100%. Skateboarding is the best. 
  1. "Not getting caught up in everyone’s bullshit"-Cardiel fucking knows, 100%. Skateboarding is the best. 

  1. 506 notesTimestamp: Sunday 2013/06/30 23:22:26Anti herojohn cardieljulien stranger100%realskateboardingstokedindependent trucksemericavansspitfirespitfire wheelsThrasher
  1. pimpdaddymata reblogged this from harrydtgr
  2. hesh-til-my-death reblogged this from harrydtgr
  3. carvedthrones reblogged this from thecomptonzoo
  4. thecomptonzoo reblogged this from hesh-til-my-death
  5. blob-ross reblogged this from hesh-til-my-death
  6. wakethefuckup90 reblogged this from harrydtgr
  7. thelostvandal reblogged this from harrydtgr
  8. namaste5456 reblogged this from soul-surfer
  9. sadbradpitt reblogged this from harrydtgr
  10. skateboardingpinball reblogged this from harrydtgr
  11. stricklybuisness reblogged this from harrydtgr
  12. voodoo-stew reblogged this from harrydtgr
  13. robertsonjames reblogged this from anti-zero
  14. dontrllyhavea reblogged this from anti-zero
  15. anti-zero reblogged this from harrydtgr
  16. shittyflowers reblogged this from harrydtgr
  17. death-marks reblogged this from harrydtgr and added:
    \
  18. mumblenyobasement reblogged this from harrydtgr
  19. atelosjc reblogged this from atelosjc
  20. mvrcuz reblogged this from katingsay-izzapay
  21. katingsay-izzapay reblogged this from harrydtgr
  22. skate-dweeb reblogged this from harrydtgr
  23. dead-sarcasms reblogged this from harrydtgr
  24. brandonolds reblogged this from thornonyourside
  25. thornonyourside reblogged this from harrydtgr
  26. childrenoftheblunts reblogged this from quasmellito
  27. a7exangel reblogged this from justinbui
  28. s-f-d-b reblogged this from 20-shot-sequence-will-brb